General Information

  • ID:  hor001246
  • Uniprot ID:  G5EEC2
  • Protein name:  FLP-7-3
  • Gene name:  flp-7
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  Expressed in eggs, all larval stages and in adult . |Expressed in the ASI sensory neurons, the ALA interneuron and the AVG interneuron from where secretion occurs. Expression in the ASI neurons is necessary and sufficient to maintain serotonin-induced fat
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0019932 obsolete second-messenger-mediated signaling; GO:0040013 negative regulation of locomotion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SPMERSAMVRF
  • Length:  11(107-117)
  • Propeptide:  MLGSRFLLLALGLLVLVLAEESAEQQVQEPTELEKSGEQLSEEDLIDEQKRTPMQRSSMVRFGRSPMQRSSMVRFGKRSPMQRSSMVRFGKRSPMQRSSMVRFGKRSPMERSAMVRFGRSPMDRSKMVRFGRSSIDRASMVRLGKRTPMQRSSMVRFGKRSMEFEMQSNEKNIEDSE
  • Signal peptide:  MLGSRFLLLALGLLVLVLA
  • Modification:  T11 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamide-like neuropeptides (PubMed:16377032, PubMed:28128367). Stimulates serotonin-induced fat loss by binding to and activating the npr-22 receptor which leads to induction of the atgl-1 lipase and subsequent fat loss (PubMed:33078707). Together with
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9WVA9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9WVA9-F1.pdbhor001246_AF2.pdbhor001246_ESM.pdb

Physical Information

Mass: 148908 Formula: C55H91N17O16S2
Absent amino acids: CDGHIKLNQTWY Common amino acids: MRS
pI: 10.4 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -28.18 Boman Index: -2992
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 35.45
Instability Index: 8212.73 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20806053
  • Title:  Mapping Neuropeptide Expression by Mass Spectrometry in Single Dissected Identified Neurons From the Dorsal Ganglion of the Nematode Ascaris Suum